PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000209761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 199aa    MW: 22423.4 Da    PI: 10.0916
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000209761genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.1e-151360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ede+l ++v++ G g+W++ +   g+ R++k+c++rw +yl
    MDP0000209761 13 KGAWSKQEDEKLTQYVEKNGEGSWRSLPLAAGLLRCGKSCRLRWVNYL 60
                     79******************************99************97 PP

2Myb_DNA-binding53.45.9e-1766111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000209761  66 RGNFGEDEEDLIIRLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 111
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-21462IPR009057Homeodomain-like
PROSITE profilePS5129414.216860IPR017930Myb domain
SMARTSM007171.2E-111262IPR001005SANT/Myb domain
SuperFamilySSF466892.79E-2812107IPR009057Homeodomain-like
PfamPF002492.7E-141360IPR001005SANT/Myb domain
CDDcd001673.80E-91560No hitNo description
PROSITE profilePS5129425.9461115IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-2663116IPR009057Homeodomain-like
SMARTSM007172.4E-1665113IPR001005SANT/Myb domain
PfamPF002499.2E-1666111IPR001005SANT/Myb domain
CDDcd001675.05E-1268111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MRKPCCEKRK TNKGAWSKQE DEKLTQYVEK NGEGSWRSLP LAAGLLRCGK SCRLRWVNYL  60
RPNVKRGNFG EDEEDLIIRL HALLGNRWSL IAGRLPGRTD NEVKNYWNTH LRRKLIQMGV  120
DPNNHRIGHT HNIGLTKPSF GSRKVNYPSK PVNSQGDKDS DHIKPLSDST SGPESNTSCS  180
GLPDLNLDLT IGPLSSFGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211526128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.170790.0leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374824.11e-146PREDICTED: myb-related protein 308-like
SwissprotP813933e-73MYB08_ANTMA; Myb-related protein 308
TrEMBLD9ZJ541e-127D9ZJ54_MALDO; MYB domain class transcription factor
STRINGVIT_01s0011g04760.t011e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-72myb domain protein 4